TA331320 CXorf40A antibody

Rabbit Polyclonal Anti-CXorf40A Antibody

See related secondary antibodies

Search for all "CXorf40A"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CXorf40A

Product Description for CXorf40A

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CXorf40A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CXorf40A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CXorf40, EOLA1, Endothelial-overexpressed lipopolysaccharide-associated factor 1, Protein CXorf40A
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TE69
Immunogen:
The immunogen for Anti-CXorf40A antibody is: synthetic peptide directed towards the C-terminal region of Human CXorf40A. Synthetic peptide located within the following region: EDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVD.
GeneID:
91966
Application WB
Background CXorf40A may have an important role of cell protection in inflammation reaction.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CXorf40A (1 products)

Catalog No. Species Pres. Purity   Source  

CXorf40A

CXorf40A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for CXorf40A (1 products)

Catalog No. Species Pres. Purity   Source  

CXorf40A overexpression lysate

CXorf40A overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn