TA331296 SMAP2 antibody

Rabbit Polyclonal Anti-SMAP2 Antibody

See related secondary antibodies

Search for all "SMAP2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SMAP2

Product Description for SMAP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SMAP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SMAP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SMAP1L, Stromal membrane-associated protein 1-like, Stromal membrane-associated protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WU79
Immunogen:
The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SMAP2. Synthetic peptide located within the following region: KVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQT.
GeneID:
64744
Application WB
Background SMAP2 is a GTPase activating protein that acts on ARF1. SMAP2 can also activate ARF6 (in vitro). It may play a role in clathrin-dependent retrograde transport from early endosomes to the trans-Golgi network.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SMAP2 (1 products)

Catalog No. Species Pres. Purity   Source  

SMAP2 (full length, N-term HIS tag, transcript variant 1)

SMAP2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.
  • LinkedIn