TA331197 BAZ1A antibody

Rabbit Polyclonal Anti-BAZ1A Antibody

See related secondary antibodies

Search for all "BAZ1A"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BAZ1A

Product Description for BAZ1A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BAZ1A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BAZ1A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ACF1, ATP-dependent chromatin-remodeling protein, ATP-utilizing chromatin assembly and remodeling factor 1, Bromodomain adjacent to zinc finger domain protein 1A, CHRAC subunit ACF1, HSPC317, WCRF180, Williams syndrome transcription factor-related chromatin-remodeling factor 180
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRL2
Immunogen:
The immunogen for anti-BAZ1A antibody: synthetic peptide directed towards the middle region of human BAZ1A. Synthetic peptide located within the following region: SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS.
GeneID:
11177
Application WB
Background BAZ1A may play a role in transcriptiol regulation. May be involved in the formation or maintence of heterochromatin playing a critical role in developmental control.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn