TA331131 PAR4 / PAWR antibody

Rabbit Polyclonal Anti-PAWR Antibody

See related secondary antibodies

Search for all "PAR4 / PAWR"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat PAR4 / PAWR

TA331131

More Views

  • TA331131
  • TA331131

Product Description for PAR4 / PAWR

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat PAR4 / PAWR.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for PAR4 / PAWR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PRKC apoptosis WT1 regulator protein, Par-4, Prostate apoptosis response 4 protein
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96IZ0
Immunogen:
The immunogen for anti-PAWR antibody: synthetic peptide directed towards the middle region of human PAWR. Synthetic peptide located within the following region: SYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGT.
GeneID:
5074
Application WB
IHC
Background The tumor suppressor WT1 represses and activates transcription. Anti-Prostate Apoptosis Response Protein Par-4 (PAWR) is a WT1-interacting protein that itself functions as a transcriptiol repressor. It contains a putative leucine zipper domain which interacts with the zinc finger D binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PAR4 / PAWR (1 products)

Catalog No. Species Pres. Purity   Source  

PAR4 / PAWR

PAR4 / PAWR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for PAR4 / PAWR (1 products)

Catalog No. Species Pres. Purity   Source  

PAWR overexpression lysate

PAWR overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn