TA331051 SULF2 antibody

Rabbit polyclonal Anti-SULF2 Antibody

See related secondary antibodies

Search for all "SULF2"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SULF2

TA331051

More Views

  • TA331051

Product Description for SULF2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SULF2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SULF2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Extracellular sulfatase Sulf-2, KIAA1247
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IWU5
Immunogen:
The immunogen for anti-SULF2 antibody: synthetic peptide directed towards the C terminal of human SULF2. Synthetic peptide located within the following region: DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW.
GeneID:
55959
Application WB
IHC
Background Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell sigling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for sigling molecules.Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell sigling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for sigling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SULF2 (3 products)

Catalog No. Species Pres. Purity   Source  

SULF2 overexpression lysate

SULF2 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

SULF2 overexpression lysate

SULF2 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

SULF2 overexpression lysate

SULF2 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn