TA331040 LIPT2 antibody

Rabbit polyclonal Anti-LIPT2 Antibody

See related secondary antibodies

Search for all "LIPT2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LIPT2

Product Description for LIPT2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LIPT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LIPT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Lipoate-protein ligase B, Lipoyl/octanoyl transferase, Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase, Putative lipoyltransferase 2 mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NK58
Immunogen:
The immunogen for Anti-LIPT2 antibody is: synthetic peptide directed towards the C-terminal region of Human LIPT2. Synthetic peptide located within the following region: KICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQ.
GeneID:
387787
Application WB
Background LIPT2 catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for LIPT2 (1 products)

Catalog No. Species Pres. Purity   Source  

LIPT2 overexpression lysate

LIPT2 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn