TA331015 GLT6D1 / GLTDC1 antibody

Rabbit polyclonal Anti-GLT6D1 Antibody

See related secondary antibodies

Search for all "GLT6D1 / GLTDC1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine, Rat GLT6D1 / GLTDC1

Product Description for GLT6D1 / GLTDC1

Rabbit anti Bovine, Equine, Human, Porcine, Rat GLT6D1 / GLTDC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GLT6D1 / GLTDC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Galactosyltransferase family 6 domain-containing 1, Glycosyltransferase 6 domain-containing protein 1
Presentation Purified
Reactivity Bov, Eq, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z4J2
Immunogen:
The immunogen for anti-GLT6D1 antibody: synthetic peptide directed towards the middle region of human GLT6D1. Synthetic peptide located within the following region: FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM.
GeneID:
360203
Application WB
Background GLT6D1 is a single-pass type II membrane protein. It belongs to the glycosyltransferase 6 family. The exact function of GLT6D1 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn