TA331013 RABGGTA antibody

Rabbit polyclonal Anti-RABGGTA Antibody

See related secondary antibodies

Search for all "RABGGTA"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RABGGTA

TA331013

More Views

  • TA331013

Product Description for RABGGTA

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RABGGTA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RABGGTA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Geranylgeranyl transferase type-2 subunit alpha, Rab GGTase alpha, Rab geranylgeranyltransferase subunit alpha
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92696
Immunogen:
The immunogen for anti-RABGGTA antibody: synthetic peptide directed towards the N terminal of human RABGGTA. Synthetic peptide located within the following region: ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL.
GeneID:
5875
Application WB
Background RABGGTA belongs to the protein prenyltransferase subunit alpha family and contains 6 PFTA repeats. RABGGTA catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-termil, such as RAB1A, RAB3A and RAB5A respectively.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RABGGTA (1 products)

Catalog No. Species Pres. Purity   Source  

RABGGTA (transcript variant 2)

RABGGTA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for RABGGTA (1 products)

Catalog No. Species Pres. Purity   Source  

RABGGTA overexpression lysate

RABGGTA overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn