TA330678 C19orf66 antibody

Rabbit Polyclonal Anti-C19orf66 Antibody

See related secondary antibodies

Search for all "C19orf66"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat C19orf66

Product Description for C19orf66

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat C19orf66.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C19orf66

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UPF0515 protein C19orf66
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUL5
Immunogen:
The immunogen for Anti-C19orf66 antibody is: synthetic peptide directed towards the N-terminal region of Human C19orf66. Synthetic peptide located within the following region: FGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSL.
GeneID:
55337
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C19orf66 (1 products)

Catalog No. Species Pres. Purity   Source  

C19orf66

C19orf66 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn