TA330637 HNF4 alpha / TCF14 antibody

Rabbit Polyclonal Anti-HNF4A Antibody

See related secondary antibodies

Search for all "HNF4 alpha / TCF14"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish HNF4 alpha / TCF14

TA330637

More Views

  • TA330637

Product Description for HNF4 alpha / TCF14

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish HNF4 alpha / TCF14.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for HNF4 alpha / TCF14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HNF4, HNF4A, Hepatocyte nuclear factor 4-alpha, NR2A1, Nuclear receptor subfamily 2 group A member 1, Transcription factor 14, Transcription factor HNF-4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P41235
Immunogen:
The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV.
GeneID:
3172
Application WB
IHC
Background The protein encoded by this gene is a nuclear transcription factor which binds D as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal domint non-insulin-dependent diabetes mellitus type I. Altertive splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012].
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HNF4 alpha / TCF14 (4 products)

Catalog No. Species Pres. Purity   Source  

HNF4 alpha / TCF14 (transcript variant 2)

HNF4 alpha / TCF14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

HNF4 alpha / TCF14 (transcript variant 5)

HNF4 alpha / TCF14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

HNF4 alpha / TCF14 (transcript variant 6)

HNF4 alpha / TCF14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

HNF4 alpha / TCF14 (transcript variant 3)

HNF4 alpha / TCF14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for HNF4 alpha / TCF14 (4 products)

Catalog No. Species Pres. Purity   Source  

HNF4A overexpression lysate

HNF4A overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

HNF4A overexpression lysate

HNF4A overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

HNF4A overexpression lysate

HNF4A overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

HNF4A overexpression lysate

HNF4A overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn