TA330555 CTBP1 antibody

Rabbit Polyclonal Anti-CTBP1 Antibody

See related secondary antibodies

Search for all "CTBP1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat CTBP1

TA330555

More Views

  • TA330555
  • TA330555

Product Description for CTBP1

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat CTBP1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CTBP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-terminal-binding protein 1, CTBP
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13363
Immunogen:
The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL.
GeneID:
1487
Application WB
IHC
Background The phosphoprotein C-termil binding protein 1 (CTBP-1) binds the C-terminus of adenovirus E1A protein. CTBP-1 is a transcriptiol repressor and may play a role during cellular proliferation. A second closely related gene, CTBP2, maps to chromosome 21.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CTBP1 (4 products)

Catalog No. Species Pres. Purity   Source  

CTBP1 (transcript variant 1)

CTBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

CTBP1 (transcript variant 2)

CTBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

CTBP1 (1-440)

CTBP1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $720.00
  OriGene Technologies GmbH

CTBP1 (1-440)

CTBP1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $290.00
  OriGene Technologies GmbH

Positive controls for CTBP1 (1 products)

Catalog No. Species Pres. Purity   Source  

CTBP1 overexpression lysate

CTBP1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn