TA330512 WDSUB1 antibody

Rabbit Polyclonal Anti-WDSUB1 Antibody

See related secondary antibodies

Search for all "WDSUB1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human WDSUB1

Product Description for WDSUB1

Rabbit anti Human WDSUB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDSUB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SAM and U-box domain-containing protein 1, WD repeat, WDSAM1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9V3
Immunogen:
The immunogen for anti-WDSUB1 antibody: synthetic peptide directed towards the middle region of human WDSUB1. Synthetic peptide located within the following region: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS.
GeneID:
151525
Application WB
Background WDSUB1 contains 1 SAM (sterile alpha motif) domain, 1 U-box domain and 7 WD repeats. The function of WDSUB1 remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WDSUB1 (1 products)

Catalog No. Species Pres. Purity   Source  

WDSUB1 (transcript variant 3)

WDSUB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn