TA330478 RNF170 antibody

Rabbit Polyclonal Anti-RNF170 Antibody

See related secondary antibodies

Search for all "RNF170"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human RNF170

Product Description for RNF170

Rabbit anti Human RNF170.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF170

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Putative LAG1-interacting protein, RING finger protein 170
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96K19
Immunogen:
The immunogen for anti-RNF170 antibody: synthetic peptide directed towards the C terminal of human RNF170. Synthetic peptide located within the following region: FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR.
GeneID:
81790
Application WB
Background RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn