TA330470 RNF122 (Center) antibody

Rabbit Polyclonal Anti-Rnf122 Antibody

See related secondary antibodies

Search for all "RNF122"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Mouse RNF122

Product Description for RNF122

Rabbit anti Human, Mouse RNF122.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF122

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RING finger protein 122
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight RNF122: 17 kDA
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8BP31
Immunogen:
Synthetic peptide corresponding to the middle region of mouse RNF122
AA Sequence:
SLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKG
GeneID:
68867
Property Center
Application

Western blotting (0.2 - 1 µg/ml).

Background RING finger protein RNF122 has been described as a new ubiquitin ligase that can ubiquitinate itself and undergoes degradation in a RING finger-dependent manner. It interacts with CAML, and its E3 ubiquitin ligase activity was noted to be dependent on the RING finger domain.
General Readings "RNF122: A novel ubiquitin ligase associated with calcium-modulating cyclophilin ligand" Peng et al. BMC Cell Biology 2010, 11:41
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Mouse, human.

Accessory Products

  • LinkedIn