TA330459 RNF25 antibody

Rabbit Polyclonal Anti-RNF25 Antibody

See related secondary antibodies

Search for all "RNF25"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human RNF25

TA330459

More Views

  • TA330459

Product Description for RNF25

Rabbit anti Human RNF25.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for RNF25

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase RNF25, RING finger protein 25
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96BH1
Immunogen:
The immunogen for anti-RNF25 antibody: synthetic peptide directed towards the middle region of human RNF25. Synthetic peptide located within the following region: CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG.
GeneID:
64320
Application WB
IHC
Background RNF25 contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitition.The protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitition.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF25 (1 products)

Catalog No. Species Pres. Purity   Source  

RNF25

RNF25 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for RNF25 (1 products)

Catalog No. Species Pres. Purity   Source  

RNF25 overexpression lysate

RNF25 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn