TA330452 RNF150 antibody

Rabbit Polyclonal Anti-RNF150 Antibody

See related secondary antibodies

Search for all "RNF150"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human RNF150

Product Description for RNF150

Rabbit anti Human RNF150.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF150

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1214, RING finger protein 150
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULK6
Immunogen:
The immunogen for Anti-RNF150 antibody is: synthetic peptide directed towards the C-terminal region of Human RNF150. Synthetic peptide located within the following region: ALGIPPNADCMDDLPTDFEGSLGGPPTNQITGASDTTVNESSVTLDPAVR.
GeneID:
57484
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for RNF150 (1 products)

Catalog No. Species Pres. Purity   Source  

RNF150 overexpression lysate

RNF150 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn