TA330412 AIF2 / AIFM2 antibody

Rabbit Polyclonal Anti-AIFM2 Antibody

See related secondary antibodies

Search for all "AIF2 / AIFM2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human AIF2 / AIFM2

TA330412

More Views

  • TA330412

Product Description for AIF2 / AIFM2

Rabbit anti Human AIF2 / AIFM2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for AIF2 / AIFM2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AMID, Apoptosis-inducing factor 2, Apoptosis-inducing factor homologous mitochondrion-associated inducer of death, Apoptosis-inducing factor-like mitochondrion-associated inducer of death, PRG3, p53-responsive gene 3 protein
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BRQ8
Immunogen:
The immunogen for anti-AIFM2 antibody: synthetic peptide directed towards the middle region of human AIFM2. Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP.
GeneID:
84883
Application WB
IHC
Background AIFM2 has significant homology to DH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. The protein encoded by this gene has significant homology to DH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AIF2 / AIFM2 (1 products)

Catalog No. Species Pres. Purity   Source  

AIF2 / AIFM2

AIF2 / AIFM2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for AIF2 / AIFM2 (1 products)

Catalog No. Species Pres. Purity   Source  

AIFM2 overexpression lysate

AIFM2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn