discontinued

TA330394 RGS3 antibody

Rabbit Polyclonal Anti-RGS3 Antibody

See related secondary antibodies

Search for all "RGS3"

Quick Overview

Rabbit anti Human RGS3

Product Description for RGS3

Rabbit anti Human RGS3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RGS3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RGP3, Regulator of G-protein signaling 3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49796
Immunogen:
The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL.
GeneID:
5998
Application WB
Background RGS3 inhibits sigl transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their ictive GDP-bound form.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RGS3 (3 products)

Catalog No. Species Pres. Purity   Source  

RGS3 (transcript variant 4)

RGS3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

RGS3 (transcript variant 1)

RGS3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

RGS3 (full length, N-term HIS tag, transcript variant 5)

RGS3 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.
  • LinkedIn