TA330347 TNFRSF25 / DR3 / TRAMP antibody

Rabbit Polyclonal Anti-TNFRSF25 Antibody

See related secondary antibodies

Search for all "TNFRSF25 / DR3 / TRAMP"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human TNFRSF25 / DR3 / TRAMP

Product Description for TNFRSF25 / DR3 / TRAMP

Rabbit anti Human TNFRSF25 / DR3 / TRAMP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TNFRSF25 / DR3 / TRAMP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AIR, APO3, Apo-3, Apoptosis-inducing receptor AIR, Apoptosis-mediating receptor DR3, Apoptosis-mediating receptor TRAMP, DDR3, Death receptor 3, LARD, Lymphocyte-associated receptor of death, Protein WSL, Protein WSL-1, TNFRSF12, Tumor necrosis factor receptor superfamily member 25, WSL, WSL1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q93038
Immunogen:
The immunogen for anti-TNFRSF25 antibody: synthetic peptide directed towards the middle region of human TNFRSF25. Synthetic peptide located within the following region: GRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP.
GeneID:
8718
Application WB
Background TNFRSF25 is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The sigl transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple altertively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The altertive splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predomintly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The sigl transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple altertively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The altertive splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predomintly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TNFRSF25 / DR3 / TRAMP (3 products)

Catalog No. Species Pres. Purity   Source  

TNFRSF25 overexpression lysate

TNFRSF25 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

TNFRSF25 overexpression lysate

TNFRSF25 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

TNFRSF25 overexpression lysate

TNFRSF25 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn