TA330215 ZNF449 antibody

Rabbit Polyclonal Anti-ZNF449 Antibody

See related secondary antibodies

Search for all "ZNF449"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat ZNF449

Product Description for ZNF449

Rabbit anti Bovine, Human, Mouse, Rat ZNF449.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF449

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZSCAN19, Zinc finger and SCAN domain-containing protein 19, Zinc finger protein 449
Presentation Aff - Purified
Reactivity Bov, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P9G9
Immunogen:
The immunogen for anti-ZNF449 antibody: synthetic peptide directed towards the C terminal of human ZNF449.
AA Sequence:
GEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVI
GeneID:
203523
Application Western blotting (0.2 - 1 µg/ml)
Background ZNF449 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 SCAN box domain. ZNF449 may be involved in transcriptional regulation.
General Readings Luo,K., (2006) Mol. Biol. Rep. 33 (1), 51-57
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified on peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF449 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF449 (full length, N-term HIS tag)

ZNF449 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.
  • LinkedIn