TA330200 GS homeobox 2 / GSH2 antibody

Rabbit Polyclonal Anti-GSH2 Antibody

See related secondary antibodies

Search for all "GS homeobox 2 / GSH2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat GS homeobox 2 / GSH2

TA330200

More Views

  • TA330200

Product Description for GS homeobox 2 / GSH2

Rabbit anti Canine, Human, Mouse, Rat GS homeobox 2 / GSH2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GS homeobox 2 / GSH2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GSX2, Homeobox protein GSH-2
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZM3
Immunogen:
The immunogen for anti-GSH2 antibody: synthetic peptide directed towards the N terminal of human GSH2.
AA Sequence:
MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGC
GeneID:
170825
Application Western blotting (0.2 - 1 µg/ml)
Immunohistochemsitry on paraffin embedded sections (4 - 8 µg/ml)
Background GSH2 belongs to the Antp homeobox family and contains 1 homeobox DNA-binding domain. It is probably a transcription factor that binds to the DNA sequence 5'-CNAATTAG-3'.
General Readings Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified on peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Dog, Mouse, Rat
Species reactivity (tested):
Human

Accessory Products

  • LinkedIn