E2F5 - TA330135 | acris-antibodies.com

Product Description for E2F5

Rabbit anti Human E2F5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	E2F transcription factor 5, E2F-5, Transcription factor E2F5, p130-binding
Presentation	Purified
Reactivity	Hu
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q15329 Immunogen: The immunogen for anti-E2F5 antibody: synthetic peptide directed towards the N terminal of human E2F5. Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN. GeneID: 1875
Application	WB
Background	E2F5 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small D tumor viruses. The E2F proteins contain several evolutiolly conserved domains found in most members of the family. These domains include a D binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of human tissues. It is more homologous to E2F4, a family member, than to other members. Both this protein and E2F4 interact with tumor suppressor proteins p130 and p107, but not with pRB.
Format	Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Purity	Source
TP324285	E2F5 (transcript variant 1)
	Human	> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / $748.00
				OriGene Technologies, Inc.
TP760686	E2F5 (N-term HIS tag, transcript variant 1)
	Human	> 80 % Preparation: . Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	E. coli	50 µg / $205.00
				OriGene Technologies, Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH