TA330113 LHX2 antibody

Rabbit Polyclonal Anti-LHX2 Antibody

See related secondary antibodies

Search for all "LHX2"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human LHX2

Product Description for LHX2

Rabbit anti Human LHX2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LHX2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein LH-2, LH2, LHX2, LIM homeobox protein 2, LIM/homeobox protein Lhx2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P50458
Immunogen:
The immunogen for anti-LHX2 antibody: synthetic peptide directed towards the middle region of human LHX2. Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA.
GeneID:
9355
Application WB
Background LHX2 is a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptiol regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LHX2 (1 products)

Catalog No. Species Pres. Purity   Source  

LHX2 (N-term HIS tag)

LHX2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.
  • LinkedIn