TA330085 NFIC antibody

Rabbit Polyclonal Anti-NFIC Antibody

See related secondary antibodies

Search for all "NFIC"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human NFIC

Product Description for NFIC

Rabbit anti Human NFIC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NFIC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CCAAT-box-binding transcription factor, NF-I/C, NFI, NFI-C, Nuclear factor 1 C-type, TGGCA-binding protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P08651
Immunogen:
The immunogen for anti-NFIC antibody: synthetic peptide directed towards the C terminal of human NFIC. Synthetic peptide located within the following region: VRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQ.
GeneID:
4782
Application WB
Background Brg- or hBrm-associated factor (BAF) complexes, a chromatin-remodeling complex family of mammalian cells, facilitate transcriptiol activity by remodeling nucleosome structure. Brg1 is the core subunit of Brg-associated factor complexes. BAF complexes can interact with NF1/CTF and RP II, and this interaction is closely dependent on the activation of gene transcription.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NFIC (1 products)

Catalog No. Species Pres. Purity   Source  

NFIC (transcript variant 1)

NFIC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn