TA329915 ERCC8 antibody

Rabbit Polyclonal Anti-ERCC8 Antibody

See related secondary antibodies

Search for all "ERCC8"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human ERCC8

Product Description for ERCC8

Rabbit anti Human ERCC8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ERCC8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CKN1, CSA, Cockayne syndrome WD repeat protein CSA, DNA excision repair protein ERCC-8, ERCC-8
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13216
Immunogen:
The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA.
GeneID:
1161
Application WB
Background ERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the R polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the R polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptiolly active genes.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ERCC8 (1 products)

Catalog No. Species Pres. Purity   Source  

ERCC8 (full length, N-term HIS tag, transcript variant 3)

ERCC8 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for ERCC8 (3 products)

Catalog No. Species Pres. Purity   Source  

ERCC8 overexpression lysate

ERCC8 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

ERCC8 overexpression lysate

ERCC8 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

ERCC8 overexpression lysate

ERCC8 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn