discontinued

AP32780PU-N SLC2A9 / GLUT9 antibody

See related secondary antibodies

Search for all "SLC2A9 / GLUT9"

Quick Overview

Rabbit anti Human, Mouse, Rat SLC2A9 / GLUT9

AP32780PU-N

More Views

  • AP32780PU-N

Product Description for SLC2A9 / GLUT9

Rabbit anti Human, Mouse, Rat SLC2A9 / GLUT9.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC2A9 / GLUT9

Product Category Primary Antibodies
Quantity 50 µg
Synonyms GLUT-9, Glucose transporter type 9, Solute carrier family 2 facilitated glucose transporter member 9
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 56 kDa (511 amino acids)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRM0
Immunogen:
Synthetic peptide directed towards the middle region of Human SLC2A9
AA Sequence:
VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
GeneID:
56606
Application ELISA: 1/1562500 (Titer).
Western Blot: 0.2-1 μg/ml.
Positive Control: HepG2 Cell Lysate.
Background SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
Concentration 1.0 mg/ml after reconstitution
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Affinity Chromatography
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Horse (92%), Guinea pig (90%), Bovine (85%), Dog (85%), Mouse (85%), Rat (78%).
Species reactivity (tested):
Human.
Specificity
Specificity:
This antibody recognizes SLC2A9/GLUT9 (middle region).

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC2A9 / GLUT9 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC2A9 overexpression lysate

SLC2A9 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

SLC2A9 overexpression lysate

SLC2A9 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn