discontinued

AP42187PU-N RFX4 antibody

See related secondary antibodies

Search for all "RFX4"

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat RFX4

Product Description for RFX4

Rabbit anti Canine, Human, Mouse, Rat RFX4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RFX4

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms NYD-SP10, Regulatory factor X 4, Testis development protein NYD-SP10, Transcription factor RFX4
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q33E94
Immunogen:
The immunogen for anti-RFX4 antibody: synthetic peptide directed towards the middle region of human RFX4.
AA Sequence:
NVDLNSITKQTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPIESYIEWL
GeneID:
5992
Application Western blotting (2 - 8 µg/ml)
Background RFX4 is a transcription factors that contain a highly-conserved winged helix DNA binding domain. RFX4 is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. RFX4 may be a transcriptional repressor rather than a transcriptional activator.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. This protein may be a transcriptional repressor rather than a transcriptional activator. Three transcript variants encoding different isoforms have been described for this gene.
General Readings Glaser,B., (2005) Mol. Psychiatry 10 (10), 920-927
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog
Species reactivity (tested):
Human
Gene ID 5992

Accessory Products

Proteins and/or Positive Controls

Positive controls for RFX4 (1 products)

Catalog No. Species Pres. Purity   Source  

RFX4 overexpression lysate

RFX4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn