discontinued

AP42286PU-N AChE Q subunit antibody

See related secondary antibodies

Search for all "AChE Q subunit"

Quick Overview

Rabbit anti Human AChE Q subunit

Product Description for AChE Q subunit

Rabbit anti Human AChE Q subunit.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for AChE Q subunit

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms Acetylcholinesterase collagenic tail peptide, Acetylcholinesterase-associated collagen, COLQ
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y215
Immunogen:
The immunogen for anti-COLQ antibody: synthetic peptide directed towards the N terminal of human COLQ.
AA Sequence:
LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLF
GeneID:
8292
Application Western blotting (1 - 4 µg/ml)
Background COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.
General Readings Ting,A.K., et al., (2005) Chem. Biol. Interact. 157-158, 63-70
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat
Species reactivity (tested):
Human
Gene ID 8292

Accessory Products

Proteins and/or Positive Controls

Positive controls for AChE Q subunit (3 products)

Catalog No. Species Pres. Purity   Source  

COLQ overexpression lysate

COLQ overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

COLQ overexpression lysate

COLQ overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

COLQ overexpression lysate

COLQ overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn