discontinued

AP42134PU-N ZNF295 antibody

See related secondary antibodies

Search for all "ZNF295"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat ZNF295

Product Description for ZNF295

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat ZNF295.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF295

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KIAA1227, ZBTB21, Zinc finger and BTB domain-containing protein 21, Zinc finger protein 295
Presentation Aff - Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULJ3
Immunogen:
The immunogen for anti-ZNF295 antibody: synthetic peptide directed towards the N terminal of human ZNF295
AA Sequence:
DQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCEPDAFDNVLNYI
GeneID:
49854
Application Western blotting (0.2 - 1.0 µg/ml)
Background ZNF295 contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZNF295 may be involved in transcriptional regulation.
General Readings Olsen,J.V., (2006) Cell 127 (3), 635-648
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Bovine, Chicken
Species reactivity (tested):
Human
Gene ID 49854

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF295 (1 products)

Catalog No. Species Pres. Purity   Source  

ZBTB21 overexpression lysate

ZBTB21 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn