discontinued

AP42262PU-N SNAPC3 / SNAP50 antibody

See related secondary antibodies

Search for all "SNAPC3 / SNAP50"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat SNAPC3 / SNAP50

Product Description for SNAPC3 / SNAP50

Rabbit anti Bovine, Canine, Human, Mouse, Rat SNAPC3 / SNAP50.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SNAPC3 / SNAP50

Product Category Primary Antibodies
Quantity 50 µg
Synonyms PSE-binding factor subunit beta, SNAP-50, SNAPc subunit 3, Small nuclear RNA-activating complex polypeptide 3, snRNA-activating protein complex 50 kDa subunit, snRNA-activating protein complex subunit 3
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92966
Immunogen:
The immunogen for anti-SNAPC3 antibody: synthetic peptide directed towards the middle region of human SNAPC3
AA Sequence:
LRDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRY
GeneID:
6619
Application

Western blotting (0.2 - 1 µg/ml)

Background SNAPC3 is a part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. It binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes and recruits TBP and BRF2 to the U6 snRNA TATA box.
General Readings "The small nuclear RNA-activating protein 190 Myb DNA binding domain stimulates TATA box-binding protein-TATA box recognition." Hinkley C.S., Hirsch H.A., Gu L., LaMere B., Henry R.W. J. Biol. Chem. 278:18649-18657(2003)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Dog
Species reactivity (tested):
Human
Gene ID 6619

Accessory Products

Proteins and/or Positive Controls

Proteins for SNAPC3 / SNAP50 (1 products)

Catalog No. Species Pres. Purity   Source  

SNAPC3 / SNAP50 (full length, N-term HIS tag)

SNAPC3 / SNAP50 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for SNAPC3 / SNAP50 (1 products)

Catalog No. Species Pres. Purity   Source  

SNAPC3 overexpression lysate

SNAPC3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn