discontinued

AP42207PU-N SUPT5H antibody

See related secondary antibodies

Search for all "SUPT5H"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog SUPT5H

AP42207PU-N

More Views

  • AP42207PU-N
  • AP42207PU-N
  • AP42207PU-N

Product Description for SUPT5H

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog SUPT5H.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SUPT5H

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DRB sensitivity-inducing factor large subunit, DSIF p160, DSIFp160, SPT5, SPT5H, Tat-CT1 protein, Tat-cotransactivator 1 protein, Transcription elongation factor SPT5
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
O00267
Immunogen:
The immunogen for anti-SUPT5H antibody: synthetic peptide directed towards the C terminal of human SUPT5H
AA Sequence:
PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA
GeneID:
6829
Application Western blotting (0.2 - 1 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)
Background SUPT5H and its binding partner regulate transcriptional elongation by RNA polymerase II. SPT4 and SPT5 are involved in both 5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole (DRB)-mediated transcriptional inhibition and the activation of transcriptional elongation by the human immunodeficiency virus type 1 (HIV-1) Tat protein.
General Readings Bourgeois,C.F., et al., (2002) Mol. Cell. Biol. 22 (4), 1079-1093
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Bovine, African clawed frog, Chicken, Zebrafish
Species reactivity (tested):
Human
Gene ID 6829

Accessory Products

Proteins and/or Positive Controls

Proteins for SUPT5H (4 products)

Catalog No. Species Pres. Purity   Source  

SUPT5H (transcript variant 1)

SUPT5H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

SUPT5H (transcript variant 4)

SUPT5H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

SUPT5H (transcript variant 2)

SUPT5H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

SUPT5H (transcript variant 3)

SUPT5H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

Positive controls for SUPT5H (1 products)

Catalog No. Species Pres. Purity   Source  

SUPT5H overexpression lysate

SUPT5H overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn