discontinued

AP42200PU-N SOX12 antibody

See related secondary antibodies

Search for all "SOX12"

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat SOX12

Product Description for SOX12

Rabbit anti Canine, Human, Mouse, Rat SOX12.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SOX12

Product Category Primary Antibodies
Quantity 50 µg
Synonyms SOX-22 protein, SOX22, SRY-box 12, SRY-box 22, Transcription factor SOX-12
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
O15370
Immunogen:
The immunogen for anti-SOX12 antibody: synthetic peptide directed towards the C terminal of human SOX12.
AA Sequence:
DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY
GeneID:
6666
Application

Western blotting (0.2 - 1.0 µg/ml)

Background Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The SOX12 gene encodes a protein that was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types.
General Readings Weiss,M.A. et al., (2001) Mol. Endocrinol. 15 (3), 353-362
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog
Species reactivity (tested):
Human
Gene ID 6666

Accessory Products

  • LinkedIn