AP42254PU-N RGS20 (isoform 6 specific) antibody

See related secondary antibodies

Search for all "RGS20"

0.1 ml / $355.00
Delivery Time: 1-3 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human RGS20

Product Description for RGS20

Rabbit anti Human RGS20.
Properties: (isoform 6 specific)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RGS20

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Gz-GAP, RGSZ1, Regulator of G-protein signaling 20, Regulator of G-protein signaling Z1, Regulator of Gz-selective protein signaling 1, ZGAP1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
O76081
Immunogen:
The immunogen for anti-RGS20 antibody: synthetic peptide directed towards the N terminal of human RGS20
AA Sequence:
KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP
GeneID:
8601
Property isoform 6 specific
Application

Western blotting (4 - 8 µg/ml)

Background Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi and Gq class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.
General Readings Xu,G.Y., et al., (2004) J. Biomol. NMR 28 (4), 409-4108
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human
Specificity
Specificity:
This antibody wil detect only isoform 6 what was chosen as the canonical sequence for this protein. The immunogenic sequence is not present on isoforms 1-5.
Gene ID 8601

Accessory Products

Proteins and/or Positive Controls

Proteins for RGS20 (1 products)

Catalog No. Species Pres. Purity   Source  

RGS20 (transcript variant 2)

RGS20 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for RGS20 (1 products)

Catalog No. Species Pres. Purity   Source  

RGS20 overexpression lysate

RGS20 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn