discontinued

AP42492PU-N ZNF92 antibody

See related secondary antibodies

Search for all "ZNF92"

Quick Overview

Rabbit anti Human, Mouse ZNF92

Product Description for ZNF92

Rabbit anti Human, Mouse ZNF92.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF92

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms HTF12, Zinc finger protein 92, Zinc finger protein HTF12
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 60 kDa (517 aa)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q03936
Immunogen:
A synthetic peptide directed towards the C-terminal region of human ZNF92 (isoform 2, Q03936-2)
AA Sequence:
KPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKL
GeneID:
168374
Application Western blotting (1 - 3 µg/ml)
Background ZNF92, belonging to the krueppel C2H2-type zinc-finger protein family, is expressed early during embryonic development and may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Bellefroid,E.J., et al., (1993) EMBO J. 12 (4), 1363-1374.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human, Mouse
Gene ID 168374

Accessory Products

  • LinkedIn