discontinued

AP42399PU-N ZNF84 antibody

See related secondary antibodies

Search for all "ZNF84"

Quick Overview

Rabbit anti Human, Mouse, Rat, African clawed frog ZNF84

AP42399PU-N

More Views

  • AP42399PU-N

Product Description for ZNF84

Rabbit anti Human, Mouse, Rat, African clawed frog ZNF84.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF84

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms HPF2, Zinc finger protein 84, Zinc finger protein HPF2
Presentation Aff - Purified
Reactivity African clawed frog, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Molecular weight 85 kDa (738 aa)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P51523
Immunogen:
A synthetic peptide directed towards the C-terminal region of human ZNF84
AA Sequence:
RKAFSQKSQLVNHQRIHTGEKPYRCIECGKAFSQKSQLINHQRTHTVKKS
GeneID:
7637
Application Western blotting (1 - 3 µg/ml).
Immunohistochemistry on paraffin embedded tissue (4-8 µg/ml).
Background ZNF84, belonging to the krueppel C2H2-type zinc-finger protein family, may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Rosati,M., et al., (2001) Cytogenet. Cell Genet. 94 (3-4), 127-130.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human, Mouse, Rat, frican clawed frog
Gene ID 7637

Accessory Products

  • LinkedIn