discontinued

AP44232PU-N ZNF79 antibody

See related secondary antibodies

Search for all "ZNF79"

Quick Overview

Rabbit anti Human ZNF79

Product Description for ZNF79

Rabbit anti Human ZNF79.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF79

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ZNFpT7, Zinc finger protein 79
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 55 kDa (498 aa)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15937
Immunogen:
A synthetic peptide directed towards the N-terminal region of human ZNF79
AA Sequence:
LEEGVLPSPGPALPQEENTGEEGMAAGLLTAGPRGSTFFSSVTVAFAQER
GeneID:
7633
Application Western blotting: 0.2-1 ug/ml.
Background Zinc finger protein 79, belonging to the krueppel C2H2-type zinc-finger protein family, may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human
Gene ID 7633

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF79 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF79 (full length, N-term HIS tag)

ZNF79 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for ZNF79 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF79 overexpression lysate

ZNF79 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn