discontinued

AP45828PU-N ACTR3B antibody

See related secondary antibodies

Search for all "ACTR3B"

Quick Overview

Rabbit anti Human ACTR3B

Product Description for ACTR3B

Rabbit anti Human ACTR3B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ACTR3B

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ARP11, ARP3 beta, ARP4, Actin-like protein 3B, Actin-related protein 3B
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P1U1
Immunogen:
Synthetic peptide directed towards the N terminal of human ACTR3B
AA Sequence:
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR
GeneID:
57180
Application Western blotting (0.2 - 1.0 µg/ml)
Background ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.
General Readings "Expression of the Arp11 gene suppresses the tumorigenicity of PC-14 human lung adenocarcinoma cells." Shindo-Okada N., Iigo M. Biochem. Biophys. Res. Commun. 312:889-896(2003)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Chicken, Rat, Guinea Pig, Dog, Horse
Species reactivity (tested):
Human
Gene ID 57180

Accessory Products

  • LinkedIn