discontinued

AP46027PU-N SLC25A25 / SCAMC2 (N-term) antibody

See related secondary antibodies

Search for all "SLC25A25 / SCAMC2"

Quick Overview

Rabbit anti Human SLC25A25 / SCAMC2

Product Description for SLC25A25 / SCAMC2

Rabbit anti Human SLC25A25 / SCAMC2.
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A25 / SCAMC2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms APC3, Calcium-binding mitochondrial carrier protein SCaMC-2, KIAA1896, MCSC3, Mitochondrial ATP-Mg/Pi carrier protein 3, Mitochondrial Ca(2+)-dependent solute carrier protein 3, SCAMC-2, Small calcium-binding mitochondrial carrier protein 2, Solute carrier family 25 member 25
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight SLC25A25: 53 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6KCM7
Immunogen:
Synthetic peptide directed towards the N terminal of human SLC25A25
AA Sequence:
KLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLR
GeneID:
114789
Property N-term
Application

Western blotting  (0.2 - 1 µg/ml).

Background Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
General Readings "Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains." del Arco A., Satrustegui J. J. Biol. Chem. 279:24701-24713(2004) [PubMed: 15054102] [Abstract]
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.
Gene ID 114789

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC25A25 / SCAMC2 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC25A25 overexpression lysate

SLC25A25 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn