AP46055PU-N SCARA3 (Center) antibody

See related secondary antibodies

Search for all "SCARA3"

0.1 ml / $430.00
Delivery Time: 1-3 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Mouse SCARA3

Product Description for SCARA3

Rabbit anti Human, Mouse SCARA3.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SCARA3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CSR, Cellular stress response gene protein, Scavenger receptor class A member 3
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight SCARA3: 65 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8C850
Immunogen:
Synthetic peptide corresponding to the middle region of mouse Scara3
AA Sequence:
KTIQTTLGASSQRISQNSESMHDLVLQVMGLQLQLDNISSFLDDHEENMH
GeneID:
219151
Property Center
Application

Western blotting  (1 µg/ml).

Background SCARA3 seems to protect cells by scavenging oxidative molecules or harmful products of oxidation.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Mouse, human.
Gene ID 219151

Accessory Products

  • LinkedIn