discontinued

AP46105PU-N RAB35 / RAB1C (Center) antibody

See related secondary antibodies

Search for all "RAB35 / RAB1C"

Quick Overview

Rabbit anti Human RAB35 / RAB1C

AP46105PU-N

More Views

  • AP46105PU-N

Product Description for RAB35 / RAB1C

Rabbit anti Human RAB35 / RAB1C.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RAB35 / RAB1C

Product Category Primary Antibodies
Quantity 50 µg
Synonyms GTP-binding protein RAY, RAY, Rab-1C, Rab-35, Ras-related protein Rab-1C, Ras-related protein Rab-35
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight RAB35: 23 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15286
Immunogen:
Synthetic peptide directed towards the middle region of human RAB35
AA Sequence:
GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK
GeneID:
11021
Property Center
Application Western blotting (0.2  - 1 µg/ml).
Background RAB35 belongs to the small GTPase superfamily. It is described as an essential rate-limiting regulator of a fast recycling pathway back to the plasma membrane in the process of endocytosis.
General Readings "Rab35 regulates an endocytic recycling pathway essential for the terminal steps of cytokinesis." Kouranti I., Sachse M., Arouche N., Goud B., Echard A. Curr. Biol. 16:1719-1725(2006) [PubMed: 16950109]
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.
Gene ID 11021

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB35 / RAB1C (3 products)

Catalog No. Species Pres. Purity   Source  

RAB35 / RAB1C

RAB35 / RAB1C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

RAB35 / RAB1C (1-203, His-tag)

RAB35 / RAB1C Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / $1,070.00
  OriGene Technologies GmbH

RAB35 / RAB1C (1-203, His-tag)

RAB35 / RAB1C Human Purified > 90 % by SDS - PAGE E. coli
50 µg / $400.00
  OriGene Technologies GmbH

Positive controls for RAB35 / RAB1C (2 products)

Catalog No. Species Pres. Purity   Source  

RAB35 overexpression lysate

RAB35 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

RAB35 overexpression lysate

RAB35 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn