TA329108 Scrt1 antibody

Rabbit Polyclonal anti-Scrt1 Antibody

See related secondary antibodies

Search for all "Scrt1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Rat Scrt1

Product Description for Scrt1

Rabbit anti Rat Scrt1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Scrt1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for Anti-Scrt1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Scrt1. Synthetic peptide located within the following region: MPRSFLVKKVKLDTFSSADLDSSYGRARSDLGVRLQDKGYLSDYVGPASV.
GeneID:
366951
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn