TA329559 RFFL / RNF189 antibody

Rabbit Polyclonal anti-RFFL antibody

See related secondary antibodies

Search for all "RFFL / RNF189"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human RFFL / RNF189

TA329559

Product Description for RFFL / RNF189

Rabbit anti Human RFFL / RNF189.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RFFL / RNF189

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CARP-2, CARP2, Caspases-8 and -10-associated RING finger protein 2, E3 ubiquitin-protein ligase rififylin, FYVE-RING finger protein Sakura, Fring, RIFIFYLIN, RING finger protein 189, RING finger protein 34-like, RNF34L
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WZ73
Immunogen:
The immunogen for anti-RFFL antibody: synthetic peptide directed towards the middle region of human RFFL. Synthetic peptide located within the following region: KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT.
GeneID:
117584
Application WB
Background RFFL has E3 ubiquitin protein ligase activity.RFFL regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. Has anti-apoptotic activity.RFFL may bind phosphatidylinositol phosphates.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn