TA329600 CBFA2T2 antibody

Rabbit polyclonal anti-CBFA2T2H antibody

See related secondary antibodies

Search for all "CBFA2T2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Mouse CBFA2T2

Product Description for CBFA2T2

Rabbit anti Mouse CBFA2T2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CBFA2T2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EHT, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, MTGR1, Myeloid translocation-related protein 1, p85
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O70374
Immunogen:
The immunogen for anti-CBFA2T2H antibody: synthetic peptide directed towards the middle region of mouse CBFA2T2H. Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS.
GeneID:
12396
Application WB
Background Mouse Cbfa2t2h associates with mSin3A, N-CoR, and histone deacetylase 3 and that when tethered to DNA, it acts as a transcriptional corepressor.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn