TA346184 Apolipoprotein B / Apo B antibody

Rabbit Polyclonal Anti-APOB Antibody

See related secondary antibodies

Search for all "Apolipoprotein B / Apo B"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human Apolipoprotein B / Apo B

Product Description for Apolipoprotein B / Apo B

Rabbit anti Human Apolipoprotein B / Apo B.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Apolipoprotein B / Apo B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Apo-B, ApoB, ApoB-100, ApoB100
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P04114
Immunogen:
The immunogen for anti-APOB antibody: synthetic peptide directed towards the middle region of human APOB. Synthetic peptide located within the following region: SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV.
GeneID:
338
Application WB
IHC
Background This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Apolipoprotein B / Apo B (2 products)

Catalog No. Species Pres. Purity   Source  

Apolipoprotein B / Apo B

Apolipoprotein B / Apo B Human Purified > 95 % Column chromatography.
single arc by IEP against whole human serum.
Plasma
0.5 mg / $260.00
  OriGene Technologies GmbH

Apolipoprotein B / Apo B (APOB 100)

Apolipoprotein B / Apo B Human Purified Method of Purification:
1. Ultracentrifugation at d 1.03-1.05
2. Delipidation with Diethyl Ether/Ethanol (3/1)
3. Gel filtration over Sephacryl S-200.
Plasma
1 mg / $330.00
  OriGene Technologies GmbH
  • LinkedIn