TA346108 SLC22A6 / OAT1 antibody

Rabbit Polyclonal Anti-SLC22A6 Antibody

See related secondary antibodies

Search for all "SLC22A6 / OAT1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC22A6 / OAT1

Product Description for SLC22A6 / OAT1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC22A6 / OAT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC22A6 / OAT1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Organic anion transporter 1, PAH transporter, PAHT, ROAT, Renal organic anion transporter 1, Solute carrier family 22 member 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4U2R8
Immunogen:
The immunogen for anti-SLC22A6 antibody: synthetic peptide directed towards the C terminal of human SLC22A6. Synthetic peptide located within the following region: ETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQEHQKYMVPLQA.
GeneID:
9356
Application WB
Background SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.The protein encoded by this gene is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC22A6 / OAT1 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC22A6 overexpression lysate

SLC22A6 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

SLC22A6 overexpression lysate

SLC22A6 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn