TA346092 PDZD1 antibody

Rabbit Polyclonal Anti-PDZK1 Antibody

See related secondary antibodies

Search for all "PDZD1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PDZD1

Product Description for PDZD1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PDZD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDZD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CAP70, NHE-RF3, NHERF-3, NHERF3, Na(+)/H(+) exchange regulatory cofactor NHE-RF3, NaPi-Cap1, PDZ domain-containing protein 1, PDZK1, Sodium-hydrogen exchanger regulatory factor 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T2W1
Immunogen:
The immunogen for anti-PDZK1 antibody: synthetic peptide directed towards the N terminal of human PDZK1. Synthetic peptide located within the following region: NSVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILSPVMNGGVQT.
GeneID:
5174
Application WB
Background PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, it may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. PDZK1 may play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. PDZK1 may potentiate the CFTR chloride channel activity. It may function to connect SCARB1 with the cellular machineries for intracellular cholesterol transport and/or metabolism. PDZK1 may be involved in the regulation of proximal tubular Na+-dependent inorganic phosphate cotransport therefore playing an important role in tubule function.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PDZD1 (3 products)

Catalog No. Species Pres. Purity   Source  

PDZD1

PDZD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

PDZD1 (1-519, His-tag)

PDZD1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

PDZD1 (1-519, His-tag)

PDZD1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for PDZD1 (1 products)

Catalog No. Species Pres. Purity   Source  

PDZK1 overexpression lysate

PDZK1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn