TA346104 LBP antibody

Rabbit Polyclonal Anti-LBP Antibody

See related secondary antibodies

Search for all "LBP"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Human, Porcine, Rabbit, Rat LBP

Product Description for LBP

Rabbit anti Canine, Equine, Human, Porcine, Rabbit, Rat LBP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LBP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Lipopolysaccharide-binding protein
Presentation Purified
Reactivity Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P18428
Immunogen:
The immunogen for anti-LBP antibody: synthetic peptide directed towards the middle region of human LBP. Synthetic peptide located within the following region: LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV.
GeneID:
3929
Application WB
Background LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP).The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the encoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP). Finally, this gene is found on chromosome 20, immediately downstream of the BPI gene.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LBP (4 products)

Catalog No. Species Pres. Purity   Source  

LBP

LBP Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / $299.00
  OriGene Technologies, Inc.

LBP

LBP Human Purified 95.0% purified recombinant protein shows a band at 58 kDa on SDS-PAGE commassie blue stained gel CHO cells
  OriGene Technologies GmbH

LBP

LBP Human Purified 95.0% purified recombinant protein shows a band at 58 kDa on SDS-PAGE commassie blue stained gel CHO cells
  OriGene Technologies GmbH

LBP

LBP Human Purified 95.0% purified recombinant protein shows a band at 58 kDa on SDS-PAGE commassie blue stained gel CHO cells
  OriGene Technologies GmbH
  • LinkedIn