TA346217 CYP2A7 antibody

Rabbit Polyclonal Anti-CYP2A7 Antibody

See related secondary antibodies

Search for all "CYP2A7"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish CYP2A7

Product Description for CYP2A7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish CYP2A7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CYP2A7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CYPIIA7, Cytochrome P450 2A7, Cytochrome P450-IIA4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P20853
Immunogen:
The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the N terminal of human CYP2A7. Synthetic peptide located within the following region: MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN.
GeneID:
1549
Application WB
Background This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum; its substrate has not yet been determined. This gene, which produces two transcript variants, is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CYP2A7 (2 products)

Catalog No. Species Pres. Purity   Source  

CYP2A7 (transcript variant 1)

CYP2A7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

CYP2A7 (transcript variant 2)

CYP2A7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for CYP2A7 (1 products)

Catalog No. Species Pres. Purity   Source  

CYP2A7 overexpression lysate

CYP2A7 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn