TA346399 GEM / KIR antibody

Rabbit Polyclonal Anti-GEM Antibody

See related secondary antibodies

Search for all "GEM / KIR"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GEM / KIR

TA346399

More Views

  • TA346399
  • TA346399

Product Description for GEM / KIR

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GEM / KIR.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GEM / KIR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTP-binding mitogen-induced T-cell protein, GTP-binding protein GEM, RAS-like protein KIR
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P55040
Immunogen:
The immunogen for anti-GEM antibody: synthetic peptide directed towards the C terminal of human GEM. Synthetic peptide located within the following region: ETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFW.
GeneID:
2669
Application WB
IHC
Background GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Format
Purification:
Protein A Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GEM / KIR (2 products)

Catalog No. Species Pres. Purity   Source  

GEM / KIR (transcript variant 2)

GEM / KIR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

GEM / KIR (transcript variant 1)

GEM / KIR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn