TA346425 Myosin-10 antibody

Rabbit Polyclonal Anti-MYH10 Antibody

See related secondary antibodies

Search for all "Myosin-10"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Myosin-10

Product Description for Myosin-10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Myosin-10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Myosin-10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cellular myosin heavy chain, MYH10, Myosin heavy chain 10, Non-muscle myosin heavy chain B, Non-muscle myosin heavy chain IIb, non-muscle, type B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35580
Immunogen:
The immunogen for anti-MYH10 antibody: synthetic peptide directed towards the N terminal of human MYH10. Synthetic peptide located within the following region: WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD.
GeneID:
4628
Application WB
Background MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn